kalsel.kemenag.go.id




Diunggah tanggal 23-10-2017 13:07:12

Mencegah Radikalisme Berbasis Agama





Berbicara Radikalisme, seolah-olah hanyalah berbicara tentang Islam yang radikal, mengapa bukan kristen yang radikal, hindu yang radikal, budha yang radikal, bukankah banyak kisah-kisah radikalisme dalam agama-agama lain?, jawabannya bahwa sebetulnya radikalisme tidak mengenal agama, karena radikalisme itu sebenarnya adalah faham seperti asal katanya yaitu “radix” artinya adalah “akar”, dipadu dengan “isme” yang berarti adalah “menginginkan perubahan dimulai dari akar”, sehingga dia tidak mau memulai dari apa yang ada, dia menganggap yang apa yang dihadapannya sebagai sebuah keyakinan adalah salah, sehingga dia harus mencerabut semuanya dan menggantinya dari mulai tumbuhnya akar yang baru. Sebabnya bermacam-macam, ada yang karena agama, ada yang karena faham agama, ada yang karena keyakinan, bahkan ada yang karena kalah judi, juga bisa menimbulkan radikalisme, dua pekan yang lalu, di Amerika Serikat di Las Vegas terjadi penembakan brutal yang menewaskan 59 orang dan mungkin akan bertambah karena ratusan lainnya luka-luka, dan itu dilakukan oleh juragan real estate yang kalah judi, jadi kalah judi bisa menimbulkan radikalisme, karena itu radikalisme bukan hanya domain agama, dan bukan hanya domain Islam. Di Indonesia sebagai penduduk Islam terbesar di dunia, menyebabkan  persoalan radikalisme ini lebih dominan tentang radikalisme yang berbasis agama.  (Ir H Muhammad Romahurmuziy MT, Rattan Inn Banjarmasin, 19 Oktober 2017)

Itulah kata pembukaRomahurmuziy dihadapan keluarga besar Kementerian Agama Kalimantan Selatan, dalam kegiatan Sosialisasi Pencegahan Radikalisme Berbasis Agama. Acara ini menurut Kakanwil Kemenag Kalsel H Noor Fahmi, adalah merupakan program kegiatan Kanwil Kementerian Agama Kalsel, dengan mengundang dan dihadiri oleh Pejabat Pimpinan Kanwil Kementerian Agama, para Kepala Kemenag Kabupaten dan Kota, para Kepala KUA, Alim Ulama, para Pimpinan Ponpes, Kepala-kepala Madrasah semua tingkatan, para penyuluh agama dan guru-guru agama se Kalimantan Selatan, hadir pula tokoh banua H Rudy Arifin dan Aditya Mufti Arifin anggota komisi III DPR RI.

Dalam kegiatan tersebut, sebagai pembicara pertama adalah Brigjend TNIAD Daru Cahyono, Kepala Badan Intelejen Daerah Kalsel, yang menyoroti dari sudut pandang intelejen dan Kamtibmas, antara lain menyampaikan; beliau mengawali pemaparannya secara sistematis dari kondisi ancamanGlobal, yaituLedakan Penduduk; daya tampung bumi hanya 4 milyar orang, sekarang sudah dua setengah milyar lebih, 400 orang lebih mati tiap hari dengan berbagai sebab.Urbanisasi Makin Cepat; kesejahteraan bagi yang menang, kesengsaraan bagi yang kalah, mobilitas urbanisasi manusia makin cepat mencari penghidupan yang lebih baik ketempat lain.Konsumsi Meningkat; konsekuensi logis makin banyak penduduk, makin banyak konsumsi, sedangkan sumberdaya untuk menyuplay konsumsi petumbuhannya melambat, maka berlakulah hukum ekonomi, banyak permintaan dibanding suplay, maka harga menjadi naik.Penurunan Kualitas Hidup dan Lingkungan; ekosistem menurun dan berubah, kualitas dan ketersediaan udara, tanah dan air mulai berkurang dan rusak. Kesenjangan Kesejahteraan; ada sebagian kecil orang yang makin kaya, sedangkan sebagian besar malah makin miskin.Dunia Tanpa Batas; teknologi informasi makin canggih, berita atau kejadian dimanapun dimuka bumi, hanya dalam hitungan detik sudah diketahui dibelahan bumi lainnya.Perkembangan Teknologi Sangat Cepat; makin mudah dan makin canggih, misalnya taxi online, ojek online, dll, disisi lain yang tidak dapat mengikuti dan tidak siap menjadi tertinggal dan merasa kalah.Perubahan Kearah Digital; semua serba digital; e-banking, e-toll, e-money, disisi lain ada yang tidak dapat mengikuti dan merasa tersisihkan.

Konflik di Wilayah Asiayang bisa menjadikanAsia Tenggara berpotensi menjadi Medan Perang baru; ISIS mulai kehilangan wilayah di Suriah, ISIS menjadi teroris yang paling kaya karena rampasan minyak, sehingga mengalihkan ke wilayah lain.Konflik  Etnis Rohingya di rohingya state; ada 7 provinsi yang terjadi konflik, dan sebagian besar masalah perebutan wilayah yang kaya mineral, tambang dan minyak, ditambah dari perebutan pengaruh bagi negara-negara yang ingin menguasai kekayaan alam rohingya, sedangkan konflik agama semacam dimanfaatkan dan sisi lain yang di blow up.Konflik Separatis di Thailand Selatan; ada 4 provinsi yang ingin memisahkan diri karena masalah ketidakadilan dalam pemerintahan dan kebebasan beragama. Sisa Anggota Al Qaeda di Afghanistan dan Pakistan; setiap hari menjadi pemandangan biasa tembak menembak dijalan-jalan dan orang yang tewas karena pertikaian.

Sedangkan di Indonesia sendiri tercatat: Jaringan MIT 11/09/2017 penembakan 2 orang polisi di Bima NTT; Juli 2017 serangan teror pendukung ISIS di Dhaka Bangladesh, tewaskan 20 orang; Kelompok Maute di Marawi Fhiliphine; dan adanya 7 orang DPO teroris Poso

Pada saat yang bersamaan ancaman lain terhadap NKRI; Krisis Ekonomi, Bencana Alam, Konflik Komunal,  Radikal Teror, Separatis, Sikap Intoleransi, Proxy War, Polemik Rohingya, Kebakaran lahan dan hutan,Konflik Sosial, Konflik Politik, Kejahatan Lintas Negara, Intervensi Asing, Cyber Crime, dan Keamanan Perbatasan.

Perkembangan Kelompok ISIS, ISIS terdesak (kalah) di Suriah dan Irak, mengalihkankan ke kawasan asia tenggara. Yang sangat miris adalah Fatwa Al Baghdadi  yang melakukan Desentralisasi ISIS bahwa; FTF (eks Tentara ISIS) kembali ke negara asal dan laksanakan “amaliyah” dalam bentuk; bom bunuh diri; Akhwat sebagai pion/martir; panduan ttg pembantaian berteknologi rendah; serangan (tabrak) mobil truk; serangan (tikam) dengan pisau; Culik sandera

Potensi Ancaman Eks ISIS yang kembali ke Indonesia: 2015-2017 ada 430 WNI yang di deportasi dari Turki, perlu pemeriksaan lebih lanjut; Pemindahan anggota kelompok teroris luar negeri belum diatur oleh Undang-undang.

Fatwa tersebut bukan omong kosong, berikut beberapa catatan tentang aksi mereka diEropa;18 Maret 2017 bomamplop di paris perancis; 7 April 2017 terortruk Stockholm swedia 18 orang tewas; 22 Mei 2017 terorbombunuhdiri di Manchester Inggris 22 orang tewas; 4 Juni 2017 terormobil van dan seranganbersenjata di London 8 orang tewas; 20 Juni 2017 dualedakan di stasiunkeretaapiBrusselBelgia; 18 Agustus 2017 terormobil di Barcelona Spanyol 13 tewas 100 terluka.

Sedangkan di Indonesia, aksi mereka tercatat; 27 Februari 2017 teror bom panci di Bandung; 11 April 2017 teror penyerangan di mapolres Purbalingga; 24 Mei 2017 teror bom bunuh diri di Jakarta; 25 Juni 2017 teror penyerangan bersenjata di mapolda Sumatera Utara; 30 Juni 2017 teror penyerangan bersenjata di masjid Falatehan Jakarta; 24 September 2017 Bommeledak di dekatmapolres Lampung.

Perkiraanjumlah FTF (orang yang bergabung menjadi tentara ISIS) di Suriah;Norwegia= 100orang, United Kingdom = 500 orang, Irlandia=30 orang, Serbia =100 orang, Bosnia = 60 orang,Belgia = 300 orang,francis=700 orang,Spanyol=100 orang,  Swiss = 10 orang, Maroko= 1500 orang, Aljazair = 1500 0rang, Italia = 50 orang, Albania = 140 orang,Turki=140 orang,Belanda=150 orang,Finlandia=30 orang, Rusia= 800 orang,Swedia=100 orang, Denmark =100 orang,Jerman = 100 orang, Austria =60 orang, Kosovo =120 orang.

Eksistensi sel teroris di Kalimantan Selatan; Napiter satu orang, deportase turki 6 orang, pada 14 November 2016 melakukan teror bom molotov di vihara Budi Dharma di Singkawang Kalbar pelaku diduga ingin perkeruh suasana.Napiter 1 orang pada satu Juli 2017 terjadi ledakan petasan rakitan di sekolah yayasan Ponpes Al Mujahidin Kabupaten pulang pisau Kalimantan Tengah.Napiter 1 orang di Kaltara.Eks Napiter bom Bali 8 orang di Kaltim dan dua orang eks Napiter bom Pasuruan berada di Kaltim, pada 13 November 2016 pelemparan bom molotov di gereja Oikumene Samarinda Kalimantan Timur.

Di Kalimantan Selatan keberadaan simpatisan teroris diakui oleh Ali Fauzi (adik dari Ali Ghufron kelompok Imam Samudera, pelaku bom Bali) tahun 2006 pernah berada di Kabupaten Tanah Bumbu dan Kabupaten Kotabaru dan dijadikan safe home dan daerah persiapan sebelum aksi di Poso.

Potensikerawanan di Kalsel: Terorisme: 1. Mayoritas muslim; 2. banyaknya pondok pesantren sebagian eksklusif;3. terdapat aliran keagamaan; 4. terdapat Ormas intoleran; 5. keberadaan simpatisan kelompok ISIS; 6. pernah menjadi tempat persinggahan kelompok teroris Poso; 7.Kemudahan/banyak jalur transportasi darat laut dan udara; 8. aksi teror di Kaltim Kalbar dan Kalteng daerah terjangkau ke Kalsel.

Faktor Agama: 1. Pro dan kontra terhadap aliran sesat; 2. Pemanfaatan isu keyakinan agama untuk tujuan politis dan mengganggu Kamtibmas; 3. munculnya provokasi dari kelompok kepentingan (tokoh LSM, Ormas) yang berusaha membenturkan antara kelompok penganut keyakinan agama; 4. mengeksploitasi sikap fanatisme sempit dan arogansi kelompok yakinan atau keagamaan tertentu untuk picu tindakan anarkis; 5. tekanan pada pemerintah untuk akomodir kepentingan kelompok atau komunitas tertentu.

Aliran Agama Bermasalah: 1. Syiah di Kota Banjarmasin Kabupaten Hsu dan Tanah Bumbu; 2. Jamaah Ahmadiyah Indonesia di Banjarmasin, HSU dan Tanah Bumbu;  3. Pengajian Juhdari di Desa kayu Abang Kabupaten HSS; 4 Aktivitas Wahabi Masjid Al Umm di Kabupaten HST; 5. Pengajian Salafi di kecamatan Kusan Hilir, Banjarmasin dan Tanah Bumbu; 6. Jamaah Yehuwa di Banjarmasin dan Banjarbaru; 7. Aliran guru Gondrong di Banjarmasin; 8. Majelis Tafsir Alquran MTA di Banjarbaru; 9. Khilafatul Muslimin di kota Kotabaru; 10.Aliran Sekar Pangestu di Tapin; 11. Aliran Syiah Imamiyah di HSU; 12. Aliran Nur Muhammad ajaran ilmu tasawuf atau ketuhanan di HSU; 13. Aliran Guru Arba’in di Kabupaten Tanah Bumbu; 14. Tarekat Tajul khalawatiyah Syekh Yusuf di Tanah Bumbu; 15. Majelis Dzikir an Nafs Musyahadah Nur Insan Kamil Pernapasan Istiqna di Batola.

Yang tidak kalah bahayanya juga adalah Narkoba, Kalimantan Selatan adalah urutan ke 17 dari 34 Provinsi pengguna narkoba terbanyak, tercatat 55 ribu orang terlibat dalam narkoba, ditambah dengan LP di Kalsel 300% melebihi kapasitas, 70% napinya adalah kasus narkoba, kriminalitas yang terjadi 80% karena terlebih dahulu mengkonsumsi narkoba.

Hal Yang Perlu Menjadi Perhatian, ( sebagai antisipasi, yang biasanya bisa menjadi pemicu konflik)Pemanfaatan bangunan gedung bukan rumah ibadat sebagai tempat ibadat harus ada;1. Izin tertulis pemilik bangunan;2. Rekomendasi tertulis oleh lurah atau Kades;3. Laporan tertulis kepada FKUB kabupaten atau kota;4. Pelaporan tertulis kepada Kepala Kantor Kemenag kabupaten kota;5. Surat keterangan pemberian izin sementara dari bupati atau walikota berlaku selama 2 tahun.

Persyaratan pendirian rumah ibadah: 1. Daftar nama dan KTP pengguna rumah ibadah paling sedikit 90 orang yang disahkan oleh pejabat setempat sesuai dengan batas wilayah; 2. Dukungan masyarakat setempat paling sedikit 60 orang yang disahkan oleh lurah atau Kades; 3. Rekomendasi tertulis Kepala Kantor Kemenag kabupaten atau kota; 4.  Rekomendasi tertulis FKUB kabupaten atau kota.

Sinergisitas faktor Global = Nasional = Regional = Eksternal = Internal terhadap ancaman NKRI =harus melibatkan elemen masyarakat; FKUB, FKDM, PDK, FKPT, INASBA, LSM, Ormas, Masyarakat, Tokoh Agama, Tokoh Masyarakat, Tokoh Adat, Tokoh Pemuda, Tokoh Wanita, Tokoh Pendidik, Ketua RT, Ketua RW,Lurah/Kepala Desa/Pembakal.

Untuk Aparat, melibatkan Intel BAIS, Intel Polri, Intel TNI, Intel Jaksa,aparatkeamananPolri-TNI, danaparatpenegakhokum.

Peran serta upaya cegah dari Elemen masyarakat, dengan cara:Laporan di wilayahnya aliran sesat; sikap masyarakat terhadap potensi konflik sosial komunal,   kepala daerah, FKPT, BIN, Ormas, LSM, informasi masyarakat.

Deradikalisasi; redam potensi konflik sosial, kendalikan fungsi APK, lapor ke kepala lingkungan terkait kominda, satu mata dan telinga, pendeteksian dini, pencegahan dini, tempat melapor cepat,  motivator  pemberi saran aparat keamanan,

Preemtif:Cipta kondisi yang kondusif; Preventif: pencegahan; Represif: penindakanTujuannya:mencegahkonfliksocial;mencegah reducer konflik SARA;mencegahaksiintoleran;aliransesat;aksiterorradikal;Sasaran:stabilitaspolitikekonomisosialbudayapertahanankeamanan

Strateginasionalpencegahanteroris media literasi: PP 19/2017,DamaiIndonesiaku,JalanDamai, BNPT.go.id

Kontra Propaganda: Peran serta pencegahan dari unsur pemerintah, tokoh agama, tokoh pendidik, tokoh masyarakat, tokoh adat, paguyuban, tokoh pemuda, LSM, media, MUI, FKUB, FKDM, APK, FKPT,Forum RT RW, dll

Deradikalisasipembinaan di dalamLapas:sasaranparanapiteroris yang tersebar di Lapasseluruhprovinsi, dengantahapan penanganan;identifikasi,rehabilitasi,edukasi, danresosialisasi.

Di masyarakatsasaranpotensiradikalmantannapiteroris,keluarganya,danjaringannya.Tahapan penanganan;identifikasi,pembinaan,pengawasan,pengembanganpembinaanpengawasan agama, danpembinaankewirausahaan

ContohVariabelPotensiRadikalisme/Terorisme di Suatu Wilayah (dengan identifikasi pola matriks jawaban : Ada atau Tidak Ada) : 1. Tidakpasangbendera 17 Agustus; 2.Menolakmenyanyikanlagukebangsaandanhormatbendera; 3.Kemiskinandankesenjangansocial;4.Rendahnyakepedulianwargamasyarakatterhadaphal yang menonjol di lingkungan;5.Intoleransimasyarakat; 6. Tidakmengakuinorma-norma universal yang berlakusepertiHukumdan HAM; 7.Pemahaman yang sempitterhadap agama; 8.Fanatismeberlebihanterhadapsuatuideologi; 9. Keberadaankelompokatauindividu yang membencipemerintahatauaparat; 10.Keberadaankelompoktertutupataueksklusif; 11. Recruitmentdankaderisasitertutupolehkelompokradikal; 12.KeberadaanwargasimpatisanIgaras; 13.KeberadaanNapiter dan eks Napiter;14.Keberadaan kelompok yang mudahmengkafirkankelompoklain yang tidaksejalan; 15.Menganggapthogutpemerintahatauaparat.

Langkah-langkah Antisipasi:Pemberdayaan forum kemitraan strategis pemerintah daerah dan masyarakat; yaitu FKDM, FKUB,  FPK,Kemitraan dengan Ormas;Dasar Hukumnya berdasarkan Permendagri Nomor 12/2006; Peraturan Bersama Menag dan Mendagri nomor 9/2006 dan 8/2006; Permendagri Nomor 34/2006 dan Permendagri nomor 44/2009; untuk terwujudnya keamanan ketentraman ketertiban masyarakat.

Menumbuhkan Kepedulian Mengetahui Kondisi Masyarakat yaitu proaktif membangun komunikasi interaksi dan hubungan, yaitu komunikasi dalam keluarga, mengenal Tetangga, saling mengenal dalam satu RT RW, dan gotong royong serta kegiatan sosial kemasyarakatan lainnya.

Pemberdayaan Kaum Muda sebagai garda terdepan; diberdayakan ke dalam kegiatan positif yang bersifat produktif dan membangun, diantaranya menanamkan rasa cinta tanah air,pemanfaatan secara optimal pemuda dalam anti radikalisasi seperti karang taruna,resimen mahasiswa, ormas kepemudaan, organisasi mahasiswa, dan komunitas kepemudaan lainnya.

Pembicara kedua sebagai Keynote Speaker adalah Ir H Muhammad Romahurmuziy, MT  Ketua Umum DPP PPP, yang juga adalah anggota Komisi XI DPR RI,dengan sub tema Toleransi Negara Bangsa dan Radikalisme dalam Perspektif Islam.

Dalam pemaparannya yang sistematis memulai dengan Ajaran toleransi dalam Islam; Allah menjadikan umat Islam sebagai Penengah atau Moderat; surah al-Baqarah ayat 143: “Dan demikian (pula) Kami telah menjadikan kamu (umat Islam) umat penengah, agar kamu menjadi saksi atas (perbuatan) manusia dan agar Rasul (Muhammad) menjadi saksi atas (perbuatan) kamu”

Allah tidak menghendaki kita Sama; Surah al-Maidah ayat 48:  “Sekiranya Allah menghendaki, niscaya kamu dijadikan-Nya satu umat (saja), tetapi Allah hendak menguji kamu terhadap pemberian-Nya kepadamu, maka berlomba-lombalah berbuat kebajikan. Hanya kepada Allah-lah kembali kamu semuanya”.

Sejak awal manusia diciptakan dengan perbedaan agar saling memahami, Quran surah al-Hujurat ayat 13:“Hai manusia, sesungguhnya Kami menciptakan kamu dari seorang laki-laki dan seorang perempuan dan menjadikan kamu berbangsa-bangsa dan bersuku-suku supaya kamu saling kenal mengenal”.

Memberi peringatan (nasehat), tidak ada kewenangan melebihi itu,  Quran surah Al Ghasiyah ayat 21-22: “Maka berilah peringatan, karena sesungguhnya kamu hanyalah orang yang memberi peringatan. Kamu bukanlah orang yang berkuasa atas mereka”

Menghargaiperbedaanantarumatberagama, Quran surah al-Kafirunayat 6:“Untukmuagamamudanuntukkulah,agamaku

Piagam Madinah sebagai konstitusi negara bangsa, dasarnya nash Alquran surah al-Hujurat ayat 13, “Hai manusia, sesungguhnya Kami menciptakan kamu dari seorang laki-laki dan seorang perempuan dan menjadikan kamu berbangsa-bangsa dan bersuku-suku supaya kamu saling kenal mengenal”.  Bunyi pasal 1 Piagam Madinah:“Sesungguhnya mereka  Satu Ummat yang membedakannya dari (umat) manusia lainnya”ini berarti= pengakuan kepada semua Penduduk Madinah tanpa memandang perbedaan agama, suku, bangsa sebagai anggota umat yang tunggal dengan hak-hak dan kewajiban yang sama.

Prinsip-prinsipnegarabangsadalam Piagam Madinah

Negara bangsa (=ummatan Wahidah);Persaudaraan (=Ukhuwah);Persamaan(=Al Musawah);Toleransi (=Tasamuh);kebebasan (=Al Hurriyah);Menegakkan yang ma’ruf dan mencegah kemungkaran (=Amar ma’ruf nahi mungkar);Musyawarah (=al-Syura);Keseimbangan (=Tawazun);Keadilan (=Al-‘Adalah);Tolong menolong (=Atta’awun);Kepemimpinan(=Imamah);Pertahanan;Ketaqwaan;Menjalankan hukum(=Amanatul hukmi).

Proses perumusanpiagam Jakarta danPancasila; BPUPKI dengan 67 anggota pada 1 Juni 1945 menghasilkandasarnegara Indonesia merdekaberupaPancasila.pada 29 April 1945membentukPanitia SembilanyaituSoekarno, M Hatta, M Yamin, Ahmad Subarjo, A AMaramis,H KaharMuzakkar, KH Wahid Hasyim,AbikusnoCokroSuyoso,danAgusSalim, yangpada 22 Juni 1945 merumuskanrancangan UUD berupaPiagam Jakarta (The Jakarta Charter).

Isi Piagam Jakarta yaitu Negara Republik Indonesia yang berkedaulatan rakyat, dengan berdasar kepada; Ketuhanan dengan kewajiban menjalankan syariat Islam bagi pemeluk-pemeluknya, menurut dasar kemanusiaan yang adil dan beradab, persatuan Indonesia, dan kerakyatan yang dipimpin oleh hikmat kebijaksanaan dalam permusyawaratan perwakilan, serta dengan mewujudkan suatu keadilan sosial bagi seluruh rakyat Indonesia.

Kronologi penghapusan 7 kata dalam Piagam Jakarta versi Muhammad Hatta; sore hari pasca dibacakannya proklamasi pada tanggal 17 Agustus 1945; seorang opsir angkatan laut Jepang datang kepada Hatta, dan mengatakan bahwa wakil-wakil Protestan dan Katolik di kawasan Indonesia Timur, sangat keberatan atas anak kalimat dalam pembukaan UUD “Ketuhanan dengan kewajiban menjalankan syariat Islam bagi pemeluk-pemeluknya”, Hatta menjawab, bahwa hal tersebut bukanlah diskriminasi karena Penetapan tersebut hanya mengikat rakyat yang beragama Islam, opsir tersebut mengingatkan apa pada semboyan yang selama ini didengungkan, yaitu bersatu kita teguh bercerai kita jatuh, Hatta mengakui bahwa opsir itu mempengaruhi pendiriannya. Esok harinya Hatta langsung memanggil empat orang yang dianggap mewakili Islam, yaitu Ki bagus Hadikusumo, Kasman Singodimedjo, Teuku Muhammad Hasan, dan KH Wahid Hasyim, dalam diskusi akhirnya mereka setuju rujukan tentang Islam dalam Mukadimah UUD 1945 dihapus, Kyai Haji Wahid Hasyim kemudian mengusulkan agar Piagam Jakarta itu diganti dengan rumusan“Ketuhanan Yang Maha Esa”, menurut KH Wahid Hasyim, yang paling dibutuhkan Indonesia saat itu adalah persatuan bangsa.

HubunganPancasiladengan Islam silaketuhanan yang Maha Esa,sebagaidasarnegaraRepublik Indonesia menurutpasal 29 ayat 1 UUD 1945, yang menjiwaisila-sila yang lain mencerminkantauhidmenurutpengertiankeimanandalam Islam,penerimaandanPengamalanPancasila,merupakanperwujudandariupayaumat Islam Indonesia,untukmenjalankansyariatagamanya. (keputusanMunasNUdi Situbondotanggal 21 Desember 1983)

DalamPancasilaterkandungcirikeislamandankeindonesiaan, yang memadukannilai-nilaiketuhanandankemanusiaan,humanismereligious,hubunganindividudanmasyarakat,kerakyatandanpermusyawaratan,sertakeadilandankemakmuran,melalui proses integrasikeislamandankeindonesiaanyangpositifitu,makaumat Islam Indonesiasebagaikekuatanmayoritas,dapatmenjadiUswatunHasanahdalammembangunnegaraPancasilamenujucita-citanasionalyang sejalandenganidealisasiBaldatunToyyibatunWarobbunGhofur(keputusanMuktamarMuhammadiyahke 47).

Ciri-ciri sikap dan paham radikal; Intoleran tidak mau menghargai pendapat dan keyakinan orang lain; Eksklusif membedakan diri dari umat Islam umumnya; Fanatik selalu merasa benar sendiri menganggap orang lain salah; Revolusioner = cenderung menggunakan cara-cara kekerasan untuk mencapai tujuan.

Radikalismebisaterjadi di semua agama;contohnyakelompok Hindu Radikal =RashtriyaSwayamsevakSangh(RSS)menyerangpertemuanibadahminggu di Kamataka India pada 3 Maret 2012, kemudiantahun 2014 melakukanpemaksaankepadaratusanpenganut Kristen danmuslimuntukpindah agama Hindu,tahun 2015 kelompokinijugamenyerangconvent of JesusdanMary school di distrik Nadiabahkantegamemperkosaseorangbiarawatitua di tempattersebut. Di sisi lain kelompok inilah yang selama ini menjadi penyebabketeganganantarumatberagama di India.

Kelompok Kristen radikaldariAmerikaSerikatbernamaTimothyVeigh,seorangterorisberkebangsaanAmerika Serikat,pelakupengeboman Oklahoma City pada tanggal 19 April 1995, bom yang terdiri dari 2300 kg bahan peledak di sebuahtrukitu, menewaskan 168 orang, kasus ini adalah serangan teroris domestik terbesar kedua dalam sejarah Amerika Serikat

Radikalisme atas nama Islam diantaranya; gerakan dengan cara kekerasan radikalisme destruktif, mereka berpegang kepada Quran dan menafsirkan secara kaku: Surah An Nahl ayat 36 “Dan sesungguhnya kami telah mengutus rasul pada tiap-tiap umat untuk menyerukan sembahlah Allah saja dan jauhilah thogut”. Surah al-Baqarah ayat 91 “Dan bunuhlah mereka dimana kamu temui mereka dan usirlah mereka dari mana mereka telah mengusir kamu” contoh yang ini adalah boko haram. Surah al-Maidah ayat 44 “Barangsiapa yang tidak memutuskan menurut apa yang diturunkan Allah, maka mereka itu adalah orang-orang yang kafir” An Nisa ayat 59 “Jika kalian berselisih dalam suatu hal maka Kembalikanlah kepada Allah dan Rasul-Nya”.

Faktor penyebab lahirnya gerakan radikalisme; Faktor internal;1. adanya legitimasi teks keagamaan menggunakan teks legitimasi, baik teks keagamaan maupun teks kultural seperti Alquran hadits, dan klasikal sources kitab kuning sebagai penopang perlawanan dan legitimasi teologis, sebuah gerakan ekstrimisme Islam;2. Frustasi yang mendalam karena tidak mampu mewujudkan cita-cita berdirinya negara Islam internasional; 3 Anggapan bahwa sistem Khilafah yang diterapkan masa lalu adalah solusi tunggal mengatasi problematika saat ini.Faktoreksternal;1.Ekonomidanpolitikyaitu kekuasaan despotik pemerintah yang menyeleweng dan nilai-nilai fundamental Islam, 2.Negara-negara Islam gagalmenjalankannilai-nilaiidealistik Islam, 3. Kondisinegaramuslim di dunia yang mayoritasbermasalahdalampencapaiankesejahteraan,menurut data Bank Dunianegaramuslim yang masuk 50 negaradenganpendapatanperkapitatertinggi di duniasangatsedikit,diantaranya; Qatar nomor 3, Uni Emirat Arab Nomor 20, Brunei Darussalam nomor 25, Arab Saudi nomor 32, Bahrain nomor 34, Indonesia menempatiurutanke 115, data tahun 2016; 4. Pengaruhbarat yang mendominasiduniadalambidangliberalism,sekularisme, dan kapitalisme

Upayanegaramencegahradikalisme; Kontraradikalisasi =yaituupayapenanamannilai-nilaikeindonesiaan,sertanilai-nilai non kekerasan, yang dalam prosesnya strategi inidilakukanmelaluipendidikan,baik formal maupunnonformal.Kontraradikalisasidiarahkankepada masyarakat umum melalui kerjasama dengan tokoh agama,tokohpendidik<span lang="IN" style="font-size: 12.0pt; line-height: 115%;

Opini Terbaru




Bagikan Halaman Ini